Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 220aa    MW: 23745.8 Da    PI: 10.6749
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                           WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                   daepgrCrRtDGKkWRCsr++++++ +CErH++rgr rsrk++e 115 DAEPGRCRRTDGKKWRCSRDAVGDQRYCERHINRGRYRSRKHVEG 159
                                   79****************************************986 PP

                           QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                                  ++FT++Q+++L++Q+l+yK++a n+PvP+ Ll++i++ 55 GPFTPTQWMELEHQALIYKHFAVNAPVPSSLLLPIKR 91
                                  59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.8E-125591IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.3085691IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.9E-145689IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.422115159IPR014977WRC domain
PfamPF088793.4E-19116158IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004979454.11e-101PREDICTED: growth-regulating factor 8-like
SwissprotQ6AWY17e-86GRF8_ORYSJ; Growth-regulating factor 8
TrEMBLA0A0A9UY241e-107A0A0A9UY24_ARUDO; Uncharacterized protein
STRINGGRMZM2G099862_P015e-92(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.13e-51growth-regulating factor 2